REVIVYX

Tesamorelin 10MG

$64.99

Chemical Information:

  • Molecular Formula: C221H366N72O67S
  • Molecular Weight: 5135.9 g/mol
  • Sequence: N-terminally modified 44-amino-acid peptide: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Category:

Product Description:

Tesamorelin is a synthetic peptide composed of a defined 44-amino-acid sequence with an N-terminal structural modification produced through controlled peptide synthesis. It is structurally characterized and utilized in laboratory research environments for analytical, biochemical, and experimental evaluation under controlled conditions. The compound is supplied as a lyophilized powder to support material stability and integrity during appropriate laboratory storage and handling.

Research Applications:

Tesamorelin is utilized in controlled laboratory research settings for applications such as:

  • Analytical characterization of peptide structure and sequence properties
  • Evaluation of peptide stability and degradation profiles under defined laboratory conditions
  • Investigation of molecular interactions within biochemical and cell-based assay systems
  • Examination of peptide behavior in controlled experimental research models

Storage and Handling:

  • Store the lyophilized powder at -20°C.
  • Once reconstituted, store at 2-8°C and use promptly, following established laboratory procedures.
  • Use appropriate laboratory handling practices to minimize contamination and preserve material integrity.

Product Specifications:

  • Purity: Refer to batch-specific HPLC or Certificate of Analysis
  • Appearance: Lyophilized white powder
  • Solubility: Soluble in suitable laboratory solvents

Compliance Notice:

Tesamorelin is FOR RESEARCH USE ONLY. It is not intended for human or veterinary use. The FDA has not evaluated this product for diagnostic, therapeutic, or clinical use. Misuse of this product is strictly prohibited and may violate applicable federal, state, or local laws. By purchasing this product, the buyer represents and warrants that it will be used exclusively for legitimate in vitro laboratory research purposes.

Reviews

There are no reviews yet.

Be the first to review “Tesamorelin 10MG”

Your email address will not be published. Required fields are marked *

Scroll to Top